Protein Info for CCNA_03905 in Caulobacter crescentus NA1000 Δfur

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 184 to 209 (26 residues), see Phobius details PF06532: NrsF" amino acids 19 to 206 (188 residues), 117.9 bits, see alignment E=2.7e-38

Best Hits

Predicted SEED Role

"Protein of unknown function DUF1109"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3IC51 at UniProt or InterPro

Protein Sequence (226 amino acids)

>CCNA_03905 hypothetical protein (Caulobacter crescentus NA1000 Δfur)
MTIDETLTPTSGGAAIWSAENLLWRLAEVAVAGALGGLLMVLAWLGVRPDLAAAVQTPVF
WIKIGYAFVLAIGAGVTACRMARGRRWGLVPLLLAAGVAGGFLTFGLVQALAMNPQALMR
LYWPTALACIVAILAIATPMLLFASYGLASVDPEKPKLVGFAGGVACGAVADVVFGLHCP
FTTFAFIAPWHTAGILTCGVAGLLLVDLFGRIRRARAPLIEGAAVE