Protein Info for CCNA_03869 in Caulobacter crescentus NA1000 Δfur

Annotation: chromosome partitioning protein ParA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF13614: AAA_31" amino acids 7 to 184 (178 residues), 210.4 bits, see alignment E=7.2e-66 PF10609: ParA" amino acids 7 to 48 (42 residues), 32.9 bits, see alignment 1.7e-11 PF06564: CBP_BcsQ" amino acids 8 to 156 (149 residues), 42.7 bits, see alignment E=1.7e-14 PF09140: MipZ" amino acids 8 to 167 (160 residues), 36.8 bits, see alignment E=1e-12 PF01656: CbiA" amino acids 9 to 235 (227 residues), 113.8 bits, see alignment E=1.9e-36 PF00142: Fer4_NifH" amino acids 14 to 259 (246 residues), 40.4 bits, see alignment E=8.9e-14 PF02374: ArsA_ATPase" amino acids 15 to 60 (46 residues), 27.4 bits, see alignment 7e-10

Best Hits

Swiss-Prot: 100% identical to PARA_CAUVC: Chromosome partitioning protein ParA (parA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to ccr:CC_3753)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GW31 at UniProt or InterPro

Protein Sequence (267 amino acids)

>CCNA_03869 chromosome partitioning protein ParA (Caulobacter crescentus NA1000 Δfur)
MSANPLRVLAIANQKGGVGKTTTAINLGTALAACGERVLLIDADPQGNCSTGLGIGRTQR
RTTLYDVLMGEAPVVDAAVKTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEAIR
ANGPYTYVLIDCPPSLNVLTVNAMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNP
RLEIQGVVLTMYDRRNSLSEQVAKDVRAHFGDKVYDAVIPRNVRVSEAPSFGKPVLLYDL
KCAGSQAYLKLAREVISRERDRQAKAA