Protein Info for CCNA_03868 in Caulobacter crescentus NA1000 Δfur

Annotation: chromosome partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 42 to 219 (178 residues), 224.7 bits, see alignment E=3.9e-71 PF02195: ParBc" amino acids 46 to 136 (91 residues), 104.5 bits, see alignment E=2.7e-34 PF17762: HTH_ParB" amino acids 187 to 235 (49 residues), 56.4 bits, see alignment 2.2e-19

Best Hits

Swiss-Prot: 100% identical to PARB_CAUVC: Chromosome-partitioning protein ParB (parB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to ccs:CCNA_03868)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GW30 at UniProt or InterPro

Protein Sequence (304 amino acids)

>CCNA_03868 chromosome partitioning protein ParB (Caulobacter crescentus NA1000 Δfur)
MESVVVGEPGMSEGRRGLGRGLSALLGEVDAAPAQAPGEQLGGSREAPIEILQRNPDQPR
RTFREEDLEDLSNSIREKGVLQPILVRPSPDTAGEYQIVAGERRWRAAQRAGLKTVPIMV
RELDDLAVLEIGIIENVQRADLNVLEEALSYKVLMEKFERTQENIAQTIGKSRSHVANTM
RLLALPDEVQSYLVSGELTAGHARAIAAAADPVALAKQIIEGGLSVRETEALARKAPNLS
AGKSKGGRPPRVKDTDTQALESDLSSVLGLDVSIDHRGSTGTLTITYATLEQLDDLCNRL
TRGI