Protein Info for CCNA_03854 in Caulobacter crescentus NA1000 Δfur
Annotation: phosphoribosyl-ATP pyrophosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to HIS2_CAUVC: Phosphoribosyl-ATP pyrophosphatase (hisE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)
KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 98% identity to cse:Cseg_4250)Predicted SEED Role
"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
- L-histidine biosynthesis (10/10 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Histidine metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.6.1.31
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B8GW16 at UniProt or InterPro
Protein Sequence (107 amino acids)
>CCNA_03854 phosphoribosyl-ATP pyrophosphatase (Caulobacter crescentus NA1000 Δfur) MSQRLTDVLQRLAATIEARKGGDPSVSYTAKLLNDPALAAKKLGEEAVETVIAAVAQGSD ALAAESADLLYHWLALMAASGVSLDAVAEKLEAREGTSGIAEKASRA