Protein Info for CCNA_03824 in Caulobacter crescentus NA1000 Δfur

Annotation: 2-polyprenylphenol 6-hydroxylase accessory protein UbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 479 to 501 (23 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 7 to 442 (436 residues), 563.8 bits, see alignment E=1e-173 PF03109: ABC1" amino acids 95 to 340 (246 residues), 211.2 bits, see alignment E=6.9e-67

Best Hits

Swiss-Prot: 38% identical to UBIB_PSEA8: Probable protein kinase UbiB (ubiB) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 100% identity to ccr:CC_3709)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCL8 at UniProt or InterPro

Protein Sequence (502 amino acids)

>CCNA_03824 2-polyprenylphenol 6-hydroxylase accessory protein UbiB (Caulobacter crescentus NA1000 Δfur)
MATLEAFWRLTGAGWALVRADALIPRELEPLLPPSAKLAGRVLRLFAGPAARKGRPGERL
AAVLERQGPAAIKMGQFLSTRADIFGAAFADDLSRLKDRLPAFPLSVAKAEIARNLGKPL
DEIFAEIGEPVAAASLAQAHPATLVDGQKVAVKVLRPGVERQVARDTAVLRLAARLAETL
VPVSRRLRPTEFVEVVIRALELEMDLRFEAAGCAELGEAMAKDPYMRAPAVCWEGVGKRV
LTLSWAEGAPLSDPAALDLPGLDRKALAENVTRGFLAQALDHGLFHADLHEGNLFIAAPA
AITAVDYGIVGRLGPGERRYLAEILYGFLNRDYARVAKIHFDAGYVPAHQDMDAFAQALR
AVGEPVFGRNAREVSMGRLLAQLFEITALFDMALRPELVLLQKTMVTVEGVARRIDPTHD
LWAAADPVVRRWIGRELSPAAKARDFAEEAIRAIKALARLAETPTTPPPVAAERLHTWPL
LWFLVGAATAGAAFVTGVLLAR