Protein Info for CCNA_03823 in Caulobacter crescentus NA1000 Δfur

Annotation: ubiquinone/menaquinone biosynthesis methyltransferase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 18 to 250 (233 residues), 267.5 bits, E=2.8e-83
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 22 to 250 (229 residues), 250.8 bits, E=4.8e-79
• PF13489: Methyltransf_23
  • amino acids 45 to 232 (188 residues), 28.8 bits, E=2.9e-10
• PF13847: Methyltransf_31
  • amino acids 60 to 187 (128 residues), 37.7 bits, E=5.1e-13
• PF13649: Methyltransf_25
  • amino acids 64 to 165 (102 residues), 52.6 bits, E=1.9e-17
• PF08241: Methyltransf_11
  • amino acids 68 to 169 (102 residues), 56.5 bits, E=1.1e-18

Best Hits

Swiss-Prot: 100% identical to UBIE_CAUVC: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 100% identity to ccr:CC_3708)

Predicted SEED Role

No annotation

MetaCyc Pathways

• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• superpathway of menaquinol-10 biosynthesis (3/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (3/10 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• superpathway of menaquinol-11 biosynthesis (2/10 steps found)
• superpathway of menaquinol-12 biosynthesis (2/10 steps found)
• superpathway of menaquinol-13 biosynthesis (2/10 steps found)
• superpathway of menaquinol-6 biosynthesis (2/10 steps found)
• superpathway of menaquinol-7 biosynthesis (2/10 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
• superpathway of menaquinol-9 biosynthesis (2/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Sequence Analysis Tools

See B8GVY5 at UniProt or InterPro

Protein Sequence (252 amino acids)

>CCNA_03823 ubiquinone/menaquinone biosynthesis methyltransferase UbiE (Caulobacter crescentus NA1000 Δfur)
MSNTSASFGFKDVDASLKAGLVRGVFDRVAKNYDIMNDLMSGGVHRLWKDAVAARLNPQP
GEVIIDCAGGTGDMARRFAKMARKAQERRGGPDATINIVDYNAEMIMAGIERGGEPEITW
TVGDAQRLPLPDAYADAYVISFGIRNVTDINAALREARRVLKPGGRFLCLEFSRPVTEPL
AKAYDAYSFKVIPQVGEWVAKDRDAYQYLVESIRRFPDQRTFAGMIEAAGFKRVTFTNFT
GGVAALHQGWAI