Protein Info for CCNA_03809 in Caulobacter crescentus NA1000 Δfur

Annotation: organic solvent resistance transport system permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 57 to 83 (27 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 21 to 266 (246 residues), 243.2 bits, see alignment E=1.9e-76 PF02405: MlaE" amino acids 55 to 263 (209 residues), 264.3 bits, see alignment E=3.8e-83

Best Hits

Swiss-Prot: 53% identical to Y080_RICFE: Probable ABC transporter permease protein RF_0080 (RF_0080) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to ccs:CCNA_03809)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CEF2 at UniProt or InterPro

Protein Sequence (269 amino acids)

>CCNA_03809 organic solvent resistance transport system permease (Caulobacter crescentus NA1000 Δfur)
MTAAEAARRVATHPIQALGRSTLATVRMVGAVGVFAVRGVIAALTPIWFLSQLRRQIVAI
GFFSLPVVGLTAVFTGAALALNIFTGGGRFNAEQVMPQIVALGITRELGPVLAALMLAGR
VSAAIAAEIGAMRATEQIDAMRTLSTDPFRYLVAPRLLAAVLTLPLLTAVADIIGIAGGW
LVATRVLEFNPTVYIRNTIDFLESWDIISGLIKAAVFGFIVALMGCYHGYNASGGARGVG
RATTHAVVSSAILIFATDYLLTTLFTHMS