Protein Info for CCNA_03786 in Caulobacter crescentus NA1000 Δfur

Annotation: heme chaperone heme-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 59 to 85 (27 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 29 to 185 (157 residues), 132 bits, see alignment E=1.3e-42 TIGR01191: heme exporter protein CcmC" amino acids 46 to 229 (184 residues), 246 bits, see alignment E=1.2e-77

Best Hits

KEGG orthology group: K02195, heme exporter protein C (inferred from 100% identity to ccr:CC_3672)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CD74 at UniProt or InterPro

Protein Sequence (247 amino acids)

>CCNA_03786 heme chaperone heme-lyase (Caulobacter crescentus NA1000 Δfur)
MDARHTFDFLTNPERFMAFSRWAAPWLGGLSAAAAVIGLTLTFMVPEDYQQGDTVRMMFI
HIPAASLSMFIYLCLGIASLLSLVYRHVLADLAAQACAPIGAVYTVLALITGSLWGRPMW
GTYWVWDARLTSVLVLLLFYLGYMALRGALEDEQKAARSAAILALVGVINLPVVKFSVDW
WNTLHQGSSTFFADKGDHLPAVYAWPAAFMALAYLGGFGALWLVRIRALVWRRKARSLSL
KLAEGAR