Protein Info for CCNA_03784 in Caulobacter crescentus NA1000 Δfur

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 132 (126 residues), 58 bits, see alignment E=6e-20 amino acids 143 to 278 (136 residues), 52.5 bits, see alignment E=3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3670)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCJ2 at UniProt or InterPro

Protein Sequence (297 amino acids)

>CCNA_03784 hypothetical protein (Caulobacter crescentus NA1000 Δfur)
MKTLAFVALALAGISWGLGFPTGKLILRETDAAHMVLLRFLVAAVAAAPFALRRPEVRAL
FRSPIVLLAGALYGVAFLVQFEGLAHVSVTVAALLVGAMPALIAVSARVLGEKVSRLSWA
GVAAATLGAALIAGKPDGASSPLGVALSIAALFLFLTWLLVLRRAPPAPNPMAIPAVSII
VAALVVLPIALIMHGPPKLALSAPAWTAIVAQGVLATLLATAAWQYGAAQVGAASAGVFI
NIEPLMGAACGVLLFGDHLTAALFAGGLLIIGGSFAVVMGERQAKPGEIQATVAPTP