Protein Info for CCNA_03770 in Caulobacter crescentus NA1000 Δfur

Annotation: malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01763: malate dehydrogenase, NAD-dependent" amino acids 3 to 310 (308 residues), 413.2 bits, see alignment E=3.1e-128 PF00056: Ldh_1_N" amino acids 5 to 143 (139 residues), 135.5 bits, see alignment E=1.4e-43 PF02866: Ldh_1_C" amino acids 148 to 311 (164 residues), 119.8 bits, see alignment E=1.3e-38

Best Hits

Swiss-Prot: 100% identical to MDH_CAUVN: Malate dehydrogenase (mdh) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 100% identity to ccs:CCNA_03770)

MetaCyc: 76% identical to malate dehydrogenase subunit (Methylorubrum extorquens AM1)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GVT2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>CCNA_03770 malate dehydrogenase (Caulobacter crescentus NA1000 Δfur)
MARAKIALIGAGMIGGTLAHIAAREELGDVILFDIAEGTPQGKALDIAEASAVFGKDVAL
KGANDYADIAGADVCIVTAGVPRKPGMSRDDLLGINLKVMKAVGEGIKAHAPNAFVICIT
NPLDAMVWALQQFSGLPKEKVIGMAGVLDSARFAYFLAEATGVSVEDIHAWTLGGHGDDM
VPMVRHSTVGGLPLPELVKQGWLSQDKLDAIVERTRKGGGEIVALLKTGSAFYAPAESAI
AMATSYLKDKKRVLPCATYLTGQYGLNDLYVGVPVVIGAGGAEKIVEFETNDDEKAMFAK
SVESVKGLMEACKAIDSSLV