Protein Info for CCNA_03719 in Caulobacter crescentus NA1000 Δfur

Annotation: undecaprenyl diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 44 to 68 (25 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 147 to 173 (27 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 7 to 255 (249 residues), 237.7 bits, see alignment E=8.5e-75 PF02673: BacA" amino acids 7 to 257 (251 residues), 258.7 bits, see alignment E=3.5e-81

Best Hits

Swiss-Prot: 100% identical to UPPP_CAUVC: Undecaprenyl-diphosphatase (uppP) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to ccr:CC_3605)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H6C3 at UniProt or InterPro

Protein Sequence (266 amino acids)

>CCNA_03719 undecaprenyl diphosphatase (Caulobacter crescentus NA1000 Δfur)
MPDWLIALILGLIEGLTEFIPVSSTGHLLLLGHFLGFHSPGNTFQVLIQLGAILAITGVY
FGRLWGLLTTLPTEPGSRRFVIGILLAFLPAVFVGVAAHDFIKTVLYETPALVCSTLIIG
GFILLALDRMKLEPRYTDVAEYPLKTAFIIGLFQCLALVPGVSRSGATIAGALLLKCDKR
SAAEFSFFLAMPTMAGAFAYDLYKNIDKLSTNDLGLIGIGFLAALVSGVFVVKTVLDFIT
RHGFAPFAYWRIAVGVVGLALLYIPR