Protein Info for CCNA_03711 in Caulobacter crescentus NA1000 Δfur

Annotation: ribosome-associated factor Y

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR00741: ribosomal subunit interface protein" amino acids 1 to 99 (99 residues), 60.2 bits, see alignment E=1.2e-20 PF02482: Ribosomal_S30AE" amino acids 3 to 95 (93 residues), 58.7 bits, see alignment E=8.1e-20 PF16321: Ribosom_S30AE_C" amino acids 139 to 191 (53 residues), 61.6 bits, see alignment E=4.8e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3597)

Predicted SEED Role

"Ribosomal subunit interface protein" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CE34 at UniProt or InterPro

Protein Sequence (208 amino acids)

>CCNA_03711 ribosome-associated factor Y (Caulobacter crescentus NA1000 Δfur)
MQVQVSGKHVDVGEALRARVSDEIALSIGKYFDRGGAAEVVVSKEGYAFRVDCSVKLASG
QQLISHGSGGDAHAAFDAALAKIDTRIRRYKRRLKSHSAAATAKQVENAAMFVLRAPESD
DVDEDWDIEDDHPTGAPAAMVIAETQAAMKTMTVSMAVMELDLTAYPAIVFRNAAHGGIS
VVYRRPDGNIGWIDPERTKSNGHGSTAS