Protein Info for CCNA_03683 in Caulobacter crescentus NA1000 Δfur

Annotation: maleylpyruvate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 TIGR01262: maleylacetoacetate isomerase" amino acids 5 to 209 (205 residues), 242.2 bits, see alignment E=2.2e-76 PF02798: GST_N" amino acids 6 to 76 (71 residues), 40.6 bits, see alignment E=4e-14 PF13417: GST_N_3" amino acids 16 to 80 (65 residues), 47.3 bits, see alignment E=3.2e-16 PF13409: GST_N_2" amino acids 16 to 77 (62 residues), 51.8 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 46% identical to NAGL_RALSP: Maleylpyruvate isomerase (nagL) from Ralstonia sp.

KEGG orthology group: K01800, maleylacetoacetate isomerase [EC: 5.2.1.2] (inferred from 100% identity to ccs:CCNA_03683)

MetaCyc: 46% identical to glutathion-dependent maleylpyruvate isomerase (Ralstonia sp. U2)
Maleylpyruvate isomerase. [EC: 5.2.1.4]

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)" (EC 2.5.1.18, EC 5.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2 or 5.2.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CFM6 at UniProt or InterPro

Protein Sequence (210 amino acids)

>CCNA_03683 maleylpyruvate isomerase (Caulobacter crescentus NA1000 Δfur)
MKLVLHSAKRASAPYRVRIGLNLKGLAFELRPVDLVANAHQGEAYRALNAQALVPTLEVD
GRPLTQSLAILEWLDETYPAHPLLPTDAFDRATVRAMAEIIACDIHPLNNLRILRQLTAL
EIDEPARNAWVARWIQDGFSALEPMIARHGQGYAFGDAPGLVDCLLVPQVFNANRFNVDL
SPFPALEAAAAHARAHPAIAAAHPDHHPER