Protein Info for CCNA_03675 in Caulobacter crescentus NA1000 Δfur

Annotation: PAS-family sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 PF08447: PAS_3" amino acids 175 to 263 (89 residues), 46.7 bits, see alignment E=6.4e-16 TIGR00229: PAS domain S-box protein" amino acids 176 to 274 (99 residues), 35.6 bits, see alignment E=4.6e-13 PF00989: PAS" amino acids 196 to 266 (71 residues), 22.7 bits, see alignment E=1.7e-08 PF07536: HWE_HK" amino acids 282 to 360 (79 residues), 85.3 bits, see alignment E=8.1e-28 PF07568: HisKA_2" amino acids 282 to 331 (50 residues), 26.3 bits, see alignment 1.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03675)

Predicted SEED Role

"FIG00482053: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCT3 at UniProt or InterPro

Protein Sequence (612 amino acids)

>CCNA_03675 PAS-family sensor histidine kinase (Caulobacter crescentus NA1000 Δfur)
MDDAPRASDDRLEAERLEAVRGLGVVDGIVNGPGLSRLIRLAARLFDAPKAAVVLVDEAR
IWRAAYVGYAGPEAPREGDLAHRVVVANAPVGLAVPIRDCAGRVLGALVVEGPGMGGPAA
EEDLQALGDLADLATEVLFGPCAKVPTLESERLDLAIAAASLGEFEWCVATNTFRISPRL
AKLSGIPEGELDSQGGNALYAYIHPDDREAVRANIDRQLAQSGRFTAEYRRTPLEHGGET
WNSVAGVMLMDADGQPSRLIGVVQDITPRKLQEAQRESLVAELDHRIKNLLAVVQSVAAQ
SARKSASLDVFLKTFAARLKSMSSAHDLLSAARWRGATLARIAAAELGGLAPTQTRWDGP
ELFLTPRAAAALSLALHELAVNAVRYGSLSTENGKVEVVWRRTPEGGFALEWLETGGPPA
VAPATKGFGATLIEDVAGRELGGAAKISYRPGGVTAMIQGAPDALADAPPIEPVSAAPER
IVETVVAADETVRPGAIAGLKVLIVEDSLLLALELEAGLEDAGVEVVGCAAELGEALSMV
ELDFDVAVLDADLNGQSVAPVAEILRSIGRPFVFATGYADKAAPMGFDAPIVRKPYNVHQ
IARAVAGVTGRA