Protein Info for CCNA_03664 in Caulobacter crescentus NA1000 Δfur

Annotation: dihydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 5 to 254 (250 residues), 216.3 bits, E=3e-68
• PF01113: DapB_N
  • amino acids 5 to 113 (109 residues), 84.1 bits, E=9e-28
• PF05173: DapB_C
  • amino acids 116 to 253 (138 residues), 152.8 bits, E=5.1e-49

Best Hits

Swiss-Prot: 100% identical to DAPB_CAUVC: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 100% identity to ccs:CCNA_03664)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

See A0A0H3CC59 at UniProt or InterPro

Protein Sequence (257 amino acids)

>CCNA_03664 dihydrodipicolinate reductase (Caulobacter crescentus NA1000 Δfur)
MSQPVKIAIAGANGRMGRAVAQALEGRSDAVVAARFERPGDAGEGLVARETALAAAEAVI
DFTLPEASVALAEEAAANGGPALVIGSTGFSDEQLDRIDAAATKIVIVRSGNYSLGVNML
MGLVRQAAAALPAQDWDIEVFEAHHKRKIDAPSGTALMLGEAAAEGRGINLAKVSDRGRD
GVTGPRKDGDIGFSVVRGGGIIGEHSVIFAGESESLTLSHSAIDRGLFARGAIAAAVWVK
GKPPGLYDMQDVLGFKK