Protein Info for CCNA_03656 in Caulobacter crescentus NA1000 Δfur

Annotation: acetyl-coenzyme A carboxylase carboxyl transferase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF01039: Carboxyl_trans" amino acids 111 to 258 (148 residues), 67.4 bits, see alignment E=5e-23

Best Hits

Swiss-Prot: 100% identical to ACCD_CAUVC: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 100% identity to ccs:CCNA_03656)

MetaCyc: 49% identical to acetyl-CoA carboxyltransferase subunit beta (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H660 at UniProt or InterPro

Protein Sequence (307 amino acids)

>CCNA_03656 acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (Caulobacter crescentus NA1000 Δfur)
MAMAEPQDPKKGDKKTAERRGGGWLSRIAPGVRGAFAKRETPENLWVKCPDTGEMIFRSD
LEAALWVTPAGRHMRIGPEARFKFTFDDGQYEALPTPPVVEDPLKFSDGKPYKDRLVAAR
KATGEPDAMAIGYGKVGGVDAVVLVQDFAFMGGSLGMAAGEGFIAAAKAALERQVPMIAF
TAAGGARMQEGALSLMQMARTTLAINELKDAALPYVVVLTDPTTGGVTASYAMLGDIHLA
EPGALIGFAGPRVIEQTIRETLPPGFQRSEYLVEKGMVDRVTHRKELPEVLGSLLGTLMM
GRKRQAA