Protein Info for CCNA_03649 in Caulobacter crescentus NA1000 Δfur

Annotation: Ser/Thr kinase-related phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 296 to 317 (22 residues), see Phobius details PF01636: APH" amino acids 27 to 294 (268 residues), 84.3 bits, see alignment E=6.2e-28

Best Hits

Swiss-Prot: 100% identical to AMGK_CAUVC: N-acetylmuramate/N-acetylglucosamine kinase (amgK) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K07102, (no description) (inferred from 100% identity to ccr:CC_3535)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDX5 at UniProt or InterPro

Protein Sequence (363 amino acids)

>CCNA_03649 Ser/Thr kinase-related phosphotransferase (Caulobacter crescentus NA1000 Δfur)
MTLSSEREAAKAAFLSANGFGDVRRESLGGDASTRAYERLHRGEQSYIFMDQPPSLETAP
CPPDASPAERAALGYNALARLAAGRVDAFVACAGWLNAQGLSAPKVLAADPAAGLAVLED
LGDDLYARLIEAGTDEAPLYDAAIDGLLAIHAAPTPKVLRYDGSTWPLLTYDDLALKTAH
DIFVEWQPRFRDISFDAAALAEWEAIWAPIRAKGEADATVFCHRDYHAENLIWLPERDGA
ARVGMLDFQDAVLAHPAWDLSMLLHDARRTVSPEREAACLDRYLAARPELDRTAFLAGYH
ALGALNIIRILGIFARLVTRDGKPRYADFIPRLWVYLDVCFADPALAELKAWFDRYVPVE
TRR