Protein Info for CCNA_03637 in Caulobacter crescentus NA1000 Δfur

Annotation: triphosphate tunnel metalloenzyme family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 PF01928: CYTH" amino acids 21 to 204 (184 residues), 110.7 bits, see alignment E=7.6e-36 PF05235: CHAD" amino acids 235 to 465 (231 residues), 161.6 bits, see alignment E=3.2e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03637)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDM4 at UniProt or InterPro

Protein Sequence (509 amino acids)

>CCNA_03637 triphosphate tunnel metalloenzyme family protein (Caulobacter crescentus NA1000 Δfur)
MARVPLEQLLTRWGDALFMDHEIELKFLIPPEAAEAILDVLDGEGAVRQLDATYYDTADH
ALRRAGFGLRVRDGEGGRKQTLKSASAGGVFSRGEWEETIAGPTPDRDALARTPVGEMLA
EAALAPVFTARVERTIRMVAAGETLIEVALDRGELSAGERQATVCELELELKTGEPQALF
DLARTLARHAPLRLSLISKAERGYGLAAGDAAPRVRRQTAALGPEASVEAALQAIGQAGL
AHLCAALEALRERPAPDSVHQARVAARRLRAMLKIFKPLSRDAAALALDAELDWLAGELD
AARDLDVFVGEVWEGSAATFEGREAFERGLKAARATAYLRMEAALESPRARDVLLEAAAW
LEAGAWTSDPALAELRTIAAAAYAADRLDRLRRRMKKGAKHFDALDAHARHRLRLKGKTL
RYAAEDLAPLFPNHPRRAERFLAAAKAVQDTLGVLNDRAIRRDLVNSCVHGDATLARAAT
EALLPCDGDKLLRAARGALDDLLDAKSFW