Protein Info for CCNA_03624 in Caulobacter crescentus NA1000 Δfur

Annotation: sodium bicarbonate cotransporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 305 to 331 (27 residues), see Phobius details PF05982: Sbt_1" amino acids 20 to 328 (309 residues), 340.5 bits, see alignment E=5e-106

Best Hits

KEGG orthology group: K07086, (no description) (inferred from 100% identity to ccs:CCNA_03624)

Predicted SEED Role

"putative sodium-dependent bicarbonate transporter" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCP4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>CCNA_03624 sodium bicarbonate cotransporter (Caulobacter crescentus NA1000 Δfur)
MFVDVLSQTLSAAAGNLLQPAVLFFALGLIAAMARSDLALPRDAAKTLSLILMLCIGFKG
GVEARAHGLDAGFLKAAGLGLALSFLLPLPAYALLRRTGLDTLTAAATAAHYGSVSVVTF
AAAQSYLSSIGQAPGGYMSAVLALMETPGLLTAIAIAALTTRGVATGQDADRASAGKLAH
EVLLNAASVVLIGGFLIGLITGEAGGERLKTFTGPVFQGVLCVFLLDLGVRAGRQLAAAR
GMNLGVLALGIVLPILGGVVALTLGWMAGLPAGDLAALAVLAASASYIAAPAAMSMALPK
ADAGVYLTLSLGVTFPFNLTIGIPLLAIAAARLAGG