Protein Info for CCNA_03599 in Caulobacter crescentus NA1000 Δfur

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR01296: aspartate-semialdehyde dehydrogenase" amino acids 12 to 345 (334 residues), 413.5 bits, see alignment E=3.4e-128 PF01118: Semialdhyde_dh" amino acids 13 to 126 (114 residues), 121.3 bits, see alignment E=3.3e-39 PF02774: Semialdhyde_dhC" amino acids 146 to 332 (187 residues), 161 bits, see alignment E=3.8e-51

Best Hits

Swiss-Prot: 62% identical to DHAS_MYCTO: Aspartate-semialdehyde dehydrogenase (asd) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 100% identity to ccs:CCNA_03599)

MetaCyc: 63% identical to aspartate-semialdehyde dehydrogenase (Streptomyces platensis)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.11

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDS9 at UniProt or InterPro

Protein Sequence (348 amino acids)

>CCNA_03599 aspartate-semialdehyde dehydrogenase (Caulobacter crescentus NA1000 Δfur)
MSFKFSRANPPHVGVVGATGLVGGMMRELLVERDFPVASLRLFASARSAGGKIDFNGQQI
VVEDAATADFSGLDIVFFSAGGSTSRELAPKAAAAGAVVIDNSSAWRSDPEVPLVVAEVN
PHALQNIPKGIVANPNCTTMAAMPVLKPLHDKAGLKRLTVSTYQAASGGGMEGIEVLSEQ
LRAGAAGDLDGLARSPDAAPLPAPRKWAVPLAYNVVPLNYVLGEDGYTEEELKLRDESRK
ILEIPGLPVSGTCVRVPVFTGHALSINAEFDGPVSVAEALDLLAAAPGVVIDDVPNPLAA
TGQDPVFVGRVRPDPTVPHGLALFVVGDNLRKGAALNAVQIAEVMLGA