Protein Info for CCNA_03578 in Caulobacter crescentus NA1000 Δfur

Annotation: ATP-dependent DNA helicase recQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 14 to 615 (602 residues), 856 bits, see alignment E=1.4e-261 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 15 to 451 (437 residues), 427.8 bits, see alignment E=5.4e-132 PF00270: DEAD" amino acids 29 to 190 (162 residues), 80.7 bits, see alignment E=2.7e-26 PF00271: Helicase_C" amino acids 227 to 332 (106 residues), 61.9 bits, see alignment E=1.7e-20 PF16124: RecQ_Zn_bind" amino acids 344 to 405 (62 residues), 42.5 bits, see alignment E=2.3e-14 PF09382: RQC" amino acids 409 to 519 (111 residues), 72.2 bits, see alignment E=8.2e-24 PF00570: HRDC" amino acids 548 to 612 (65 residues), 76.3 bits, see alignment E=3.7e-25

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to ccr:CC_3465)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDG4 at UniProt or InterPro

Protein Sequence (615 amino acids)

>CCNA_03578 ATP-dependent DNA helicase recQ (Caulobacter crescentus NA1000 Δfur)
MYVPPESPELDRARDVLRRTFGHADFRGLQAGVIHELLTGHSAMAVLPTGGGKSLCYQIP
SLIRPGLGLVISPLIALMADQVQGLRQAGVAAERLDSNISMDERSDIWRRIDAGEVDLLY
LSPEGLMQPWMLDRLSRTPLALIAVDEAHCVSQWGHDFRPEYRMLGRLAELFPDAPRLAV
TATADARTRDDIRAELRLQGAAEFVDSFARPELALSAERKRGKGHDRVVELVLERPGRSG
VIYAGSRDGTEKLAERLNAEGVPALAYHAGLDKAVRARRLEDFLEADAAVMVATIAFGMG
VDKPDVRYVIHADPPAAIEAYWQEVGRAGRDGQPAEGITLYGSADMAWAARRIETREAPD
EVKQVQSRKLRQFYAMLEGVTCRAAAVRRYFGEEGVGHCGVCDICVSPPTGIDATQAAQK
ALSAVHRLGGRLGRGRVIEHLMGKTKDVTPQEAQLPTFGIGREFSQPTWRDLFDTLIFEG
LLREDPNDGRPLIGLGDVEGVRQVYRNERKVALRQTTDAPDSGGRAGGGMRKRREGRALT
IPAENQLLFEALRSWRKEQAQLQHVPPYVIFHDATLAEIAAARPATLAALGKAGGVGQGK
LDRYGEAVLKVVREN