Protein Info for CCNA_03507 in Caulobacter crescentus NA1000 Δfur

Annotation: GGDEF/EAL phosphodiesterase PdeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 PF21815: PdeA_PAS" amino acids 12 to 117 (106 residues), 185.3 bits, see alignment E=3.1e-59 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 127 to 273 (147 residues), 51.6 bits, see alignment E=4.4e-18 PF00990: GGDEF" amino acids 128 to 271 (144 residues), 62.4 bits, see alignment E=7e-21 PF00563: EAL" amino acids 293 to 529 (237 residues), 244.2 bits, see alignment E=1.8e-76

Best Hits

KEGG orthology group: K13245, c-di-GMP-specific phosphodiesterase [EC: 3.1.4.52] (inferred from 100% identity to ccr:CC_3396)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDG5 at UniProt or InterPro

Protein Sequence (555 amino acids)

>CCNA_03507 GGDEF/EAL phosphodiesterase PdeA (Caulobacter crescentus NA1000 Δfur)
MSFRTGERRIWDATATLEALGAADVALWIWEPETDRLRLNGAARALGLGPLAPECSSAAF
RALALPQDRAQAEEVLKPREPGSEVVARFRVRGGETCLWRGVWLEEGVRAAGVVAPETKF
SASELCDLTGLLDRRSFLARARERLAQEGTHQLVVADLDRLRRLNEALGHERADLVLAAL
GSRLAAAFPAQSILGRIGEDEFAVLCQPLGYEPSDVLRSALEQPLRVAGFDIHPTLSIGA
VSAEGGLDAPDAAELLRRAELAVEAAAAAGRGGAAAYGRAMETDGLSRLALEADLRGAIG
RGEITPYFQPIVRLSTGALSGFEALARWIHPRRGMLPPDEFLPLIEEMGLMSELGAHMMH
AAAQQLSTWRAAHPAMGNLTVSVNLSTGEIDRPGLVADVAETLRVNRLPRGALKLEVTES
DIMRDPERAAVILKTLRDAGAGLALDDFGTGFSSLSYLTRLPFDTLKIDRYFVRTMGNNA
GSAKIVRSVVKLGQDLDLEVVAEGVENAEMAHALQSLGCDYGQGFGYAPALSPQEAEVYL
NEAYVDGAAPVKARG