Protein Info for CCNA_03505 in Caulobacter crescentus NA1000 Δfur

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF08534: Redoxin" amino acids 4 to 157 (154 residues), 127.4 bits, see alignment E=4e-41 PF00578: AhpC-TSA" amino acids 6 to 138 (133 residues), 50.9 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 54% identical to PRX2B_ARATH: Peroxiredoxin-2B (PRXIIB) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03505)

MetaCyc: 54% identical to glutaredoxin-dependent peroxiredoxin (Arabidopsis thaliana col)
RXN-20687 [EC: 1.11.1.25]

Predicted SEED Role

"Peroxiredoxin"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CD91 at UniProt or InterPro

Protein Sequence (160 amino acids)

>CCNA_03505 peroxiredoxin (Caulobacter crescentus NA1000 Δfur)
MAIKVGDTLPAATFMTSTAEGPAPISTDDIFKGKTVALFAVPGAFTPTCSAKHLPGFKEK
ADELKAKGVDSIVCVSVNDVFVMKAWGKDQGIDGEVLLIADGNGDFTKAIGLDFDGSKFG
MGARSQRYSLVAKDGVVTQLHVEDAGQFKVSSAEYLLEQL