Protein Info for CCNA_03502 in Caulobacter crescentus NA1000 Δfur

Annotation: YceI/cytochrome b561 periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 7 to 187 (181 residues), 99.1 bits, see alignment E=2.6e-32 PF04264: YceI" amino acids 271 to 424 (154 residues), 106.4 bits, see alignment E=1.8e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3391)

Predicted SEED Role

"Cytochrome b561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CF39 at UniProt or InterPro

Protein Sequence (427 amino acids)

>CCNA_03502 YceI/cytochrome b561 periplasmic protein (Caulobacter crescentus NA1000 Δfur)
MAENRTRYTTVAIVLHWLIAAAIIFQIILGWRAEDGPKGPTTFALMQLHKSIGITILLLS
LARLGWRLVNPAPPAPVGQPRWEQTASKIVHIGFYVIMIGLPLTGWILVSTSRTNLPTLL
FGAIPWPHLPLLPELAAGPKHLWHEIGEIGHNVLVKTTYLLLALHLGAVAKHQILDKDAV
FQNMAPGAKPGWKEPRLWLAAAGFAAVVAAGYLYMPSAAPSAPPPAPAEAAPAVEPVAAP
AATTDPAATPQAAAAPPVSALKDPVAWTVQKGATLGFTATWSGASIEGRFQRWTAEILFS
PEALDRSEVTVGVDLASTETGDAQRDASLTGEDFLDTADHPKAVFTATKFRKTGEGRYVA
DGTLDLRGVKKPLSLPFSLKIDGDTATASGVTTLDRTTFGVGQGEWASTDEIAAQVKVSF
KLTAKRK