Protein Info for CCNA_03475 in Caulobacter crescentus NA1000 Δfur

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00938: homoserine kinase
  • amino acids 1 to 307 (307 residues), 505.8 bits, E=2.2e-156
• PF01636: APH
  • amino acids 27 to 258 (232 residues), 150.2 bits, E=4.4e-48

Best Hits

Swiss-Prot: 100% identical to KHSE_CAUVC: Homoserine kinase (thrB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02204, homoserine kinase type II [EC: 2.7.1.39] (inferred from 100% identity to ccr:CC_3364)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

See B8H4W6 at UniProt or InterPro

Protein Sequence (317 amino acids)

>CCNA_03475 homoserine kinase (Caulobacter crescentus NA1000 Δfur)
MAVYTDITDQELEAFLEGYDLGAPLAFKGIAEGVENSNFLLETEKGRYILTVYERRVKAE
DLPYFLNMLTWLADRGYPSARPIPTRSGATLSSLRGKPAAIVEFLPGLSVRKPTAAHCRE
AGEGLAWLHLAGEGYPGRRANDLGQAAWSPLFSKHRKAAEDLKPGLSATIDNDLAQLSLM
WPRNLPTGTIHADYFPDNVFFQSNGKFAAAIDFYFACDDAYAYDVAVTLNAWCFEADGSF
NITAAKALLNGYERRRPLSPIEKEALPILARGAAMRFFLTRLADWGSTPAGALVRPKDPL
EYERKLAVHREGLVLFA