Protein Info for CCNA_03424 in Caulobacter crescentus NA1000 Δfur

Annotation: AAA-family response regulator tacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 PF00072: Response_reg" amino acids 5 to 115 (111 residues), 93.7 bits, see alignment E=2.4e-30 PF00158: Sigma54_activat" amino acids 144 to 311 (168 residues), 240.7 bits, see alignment E=2.1e-75 PF14532: Sigma54_activ_2" amino acids 145 to 315 (171 residues), 70.3 bits, see alignment E=6.1e-23 PF07728: AAA_5" amino acids 167 to 286 (120 residues), 26.3 bits, see alignment E=2.1e-09 PF02954: HTH_8" amino acids 437 to 477 (41 residues), 51.7 bits, see alignment 1.8e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3315)

Predicted SEED Role

"Response regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC96 at UniProt or InterPro

Protein Sequence (488 amino acids)

>CCNA_03424 AAA-family response regulator tacA (Caulobacter crescentus NA1000 Δfur)
MTKTVLVVDDDPTQRRLIQAVLERDGFAVSHAEGGDAAIAHLTSGAPADVILLDLVMPGL
NGQDALKEMRARGFNQPVIVLTASGGVDTVVKAMQAGACDFFIKPASPERITVSIRNALS
MGDLKGEVERLTKRAGGKTTFADLIGASPVMTMVKRMGERAAKSGIPVLITGESGVGKEL
IARAVHGSSDRAGKPFVAVNCGAIPENLVESILFGHEKGSFTGATDKHLGKFKEADGGTL
FLDEVGELPLDMQVKLLRALQEGEIDPIGSKRSIKVDVRIVSATNRDLQQAVSGGRFRED
LFYRLNVFPIEAPSLRERREDIPALVEAFIRRFNVEEGKRVIGASPETMQLLTSFDWPGN
VRQLENTVYRAIVLADAPYLQPFDFPAISGLAAPIEAVSISPSPPPAALLQATHAAMAAA
VAEAPVRILDDRGHLRTLEEIERDLIQHAIDVYAGHMSEVARRLGIGRSTLYRKVREQGI
EVDMKEAG