Protein Info for CCNA_03346 in Caulobacter crescentus NA1000 Δfur

Annotation: crossover junction endodeoxyribonuclease ruvC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR00228: crossover junction endodeoxyribonuclease RuvC" amino acids 15 to 164 (150 residues), 145.6 bits, see alignment E=5.7e-47 PF02075: RuvC" amino acids 15 to 162 (148 residues), 148 bits, see alignment E=9.8e-48

Best Hits

Swiss-Prot: 100% identical to RUVC_CAUVC: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 100% identity to ccs:CCNA_03346)

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CD11 at UniProt or InterPro

Protein Sequence (173 amino acids)

>CCNA_03346 crossover junction endodeoxyribonuclease ruvC (Caulobacter crescentus NA1000 Δfur)
MREHMMNANRLPTRILGLDPGLRRTGWGVLAVEGSRMTHIAHGVITPDEKAEFADRLLHL
FEGITAVIEQHRPDEAAVEEVFLNTNAQSTLKLGHARAAALIAPARAGLLVAEYSTRLVK
KAVVGTGAADKAQIGFMIARLLPTAGKTTADCADALAVAITHANLRVANRRVA