Protein Info for CCNA_03334 in Caulobacter crescentus NA1000 Δfur

Annotation: cell division protein FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details PF06480: FtsH_ext" amino acids 7 to 93 (87 residues), 49.7 bits, see alignment E=9.3e-17 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 99 to 592 (494 residues), 788.9 bits, see alignment E=9.9e-242 PF07728: AAA_5" amino acids 188 to 308 (121 residues), 25.7 bits, see alignment E=2.6e-09 PF00004: AAA" amino acids 188 to 319 (132 residues), 161.9 bits, see alignment E=2.8e-51 PF17862: AAA_lid_3" amino acids 342 to 386 (45 residues), 62.3 bits, see alignment 5.8e-21 PF01434: Peptidase_M41" amino acids 401 to 591 (191 residues), 228.6 bits, see alignment E=1.5e-71

Best Hits

Swiss-Prot: 100% identical to FTSH_CAUVN: ATP-dependent zinc metalloprotease FtsH (ftsH) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to ccs:CCNA_03334)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H444 at UniProt or InterPro

Protein Sequence (626 amino acids)

>CCNA_03334 cell division protein FtsH (Caulobacter crescentus NA1000 Δfur)
MNFRNLAIWLVIVAVLGGVFVVSQNSRTKSSSEISYSQLLKDVDAGKIKSAEIAGQTVLA
KTADNKTLTVNAPMNSEELVNRMVAKNADVKFKSGSISFLAILVQLLPILLVVGVWLFLM
RQMQGGAKGAMGFGKSKARLLTENKNRITFEDVAGVDEAKEELQEVVDFLKDPAKFQRLG
GKIPKGALLVGPPGTGKTLIARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDMFEQAK
KNAPCIIFIDEIDAVGRHRGAGLGGGNDEREQTLNQLLVEMDGFEANEGIILIAATNRPD
VLDPALLRPGRFDRQVVVPNPDVAGREKIIRVHMKNVPLAADVDVKTLARGTPGFSGADL
ANLVNEAALMAARKNRRMVTMQDFEQAKDKVMMGAERRSMAMNEEEKKLTAYHEGGHAIV
ALNVPLADPVHKATIVPRGRALGMVMQLPEGDRYSMKYQQMTSRLAIMMGGRVAEEIIFG
KENITSGASSDIKAATDLARNMVTRWGYSDILGTVAYGDNQDEVFLGHSVARTQNVSEET
ARLIDSEVKRLVQYGLDEARRILTDKIDDLHTLGKALLEYETLSGEEIADILKGIPPKRE
EEEAATAVIAPSLVPLSPGAGASVTA