Protein Info for CCNA_03333 in Caulobacter crescentus NA1000 Δfur

Annotation: PAS-family sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 797 PF08448: PAS_4" amino acids 174 to 260 (87 residues), 33 bits, see alignment E=1.2e-11 amino acids 296 to 387 (92 residues), 32.7 bits, see alignment E=1.5e-11 PF00512: HisKA" amino acids 427 to 491 (65 residues), 30.6 bits, see alignment E=5.8e-11 PF02518: HATPase_c" amino acids 535 to 654 (120 residues), 74.2 bits, see alignment E=2.3e-24 PF00072: Response_reg" amino acids 679 to 790 (112 residues), 59 bits, see alignment E=1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03333)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CD01 at UniProt or InterPro

Protein Sequence (797 amino acids)

>CCNA_03333 PAS-family sensor histidine kinase (Caulobacter crescentus NA1000 Δfur)
MSTRPCPARRSPTSSRASPPSAKRKRRPRRSLRRPWCRCRRARAPASPPDPHQRSQRKAG
SKGPAFLFARFFRDAPQPETARPVKAWPCQCGFGAVRLDTVSANQPRGLPAPPDPPAFLA
RMGDAGLAIAAHDWSEIPMGFPQAWPPALKVAAGMMLASPIPSFLAWGDEALLLHNDAAR
ALLVARGLGARFDDVFPIPAGLPLLRRARAGESVVQECVGFTRDNGEAAWCNLMFSPVCG
DEGQVLGVLVLCNDITARVRQERAHRADERRYQALFESMDEGFCVIEFFDGPHGPDSDYV
HIMANAAYERHAGIFNVVGQTLREVVPEEADAWVARYGAVLRTGEPIRFEQELVATGRHL
ELSSFRIEPPELKQVAVLFQDVTARKRAEADLRGLNETLESRIAQALAERERTEEALRQA
QKMEAVGQLTGGLAHDFNNLLAGISGSFEMIGARLAQGRAGEVERYLTAGQGAARRAAAL
THRLLAFSRRQTLAPRPMVVNRLLPDFVELVRRTVGPSIKVENVAATGLWPTLVDANQLE
NALLNLCINARDAMPDGGKIMIETSNRWLDGPAAREHGLDPGQYVSVSVSDTGTGIDKAT
LERVFDPFFTTKPIGQGTGLGLSMVYGFARQSNGHVRIYSEVGHGTTVCLYLPRHLGEEE
VETSTTAPYAPHVQADKTVLVVDDEPTVRMLVVDTLSELGYACLEAPDGAAGLRILQSGR
QVDLLITDVGLPGGLNGRQVADGARALLPRLKVLFITGYAENAVLNHGHIEYGMEVLTKP
FAVSDLTGRVDRMLGEA