Protein Info for CCNA_03332 in Caulobacter crescentus NA1000 Δfur

Annotation: dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01496: dihydropteroate synthase
  • amino acids 9 to 266 (258 residues), 342.3 bits, E=1.1e-106
• PF00809: Pterin_bind
  • amino acids 10 to 252 (243 residues), 285 bits, E=2.8e-89

Best Hits

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 100% identity to ccr:CC_3224)

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• tetrahydrofolate biosynthesis II (2/3 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

See A0A0H3CCU6 at UniProt or InterPro

Protein Sequence (274 amino acids)

>CCNA_03332 dihydropteroate synthase (Caulobacter crescentus NA1000 Δfur)
MSTAFRPRVMGIVNVTPDSFSDGGKFLAAQDGVEHARRLIAQGADILDIGGESTRPGAAP
VSEFDEILRVVPLIEAVRRASDVPVSIDTMKPAVARAAVKAGATMWNDVTALRFSPDAPE
VAAELGCEVVLMHMLGEPGTMQDAPRYDDVVSEVEAFLLARAFTAMAAGVAKDKIWLDPG
IGFGKTLAHNLALIAALPRFVALGYPILLGASRKRFIAGIDSSAHEASDRLGGSIAAHLA
GAEAGVAAVRVHDVRETVQALDVLRAIRGAGSPP