Protein Info for CCNA_03315 in Caulobacter crescentus NA1000 Δfur

Annotation: molybdopterin biosynthesis MoeA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF03453: MoeA_N" amino acids 12 to 171 (160 residues), 131.8 bits, see alignment E=2.8e-42 PF00994: MoCF_biosynth" amino acids 184 to 320 (137 residues), 82.7 bits, see alignment E=3.3e-27 PF03454: MoeA_C" amino acids 334 to 405 (72 residues), 61.4 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to ccs:CCNA_03315)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCZ0 at UniProt or InterPro

Protein Sequence (408 amino acids)

>CCNA_03315 molybdopterin biosynthesis MoeA protein (Caulobacter crescentus NA1000 Δfur)
MADSPSANLRNLTVEEARRRMLDGASRLGVETAPLAESLGRTLAEPVVAGRAQPPFAASA
MDGWAIRRSDYAPGAAFRIVGESAAGAAYPRPVASGEAVRIFTGAPVPAEADLVIIQEEA
TREGDQVRFDAGPDPRANVRAAGGDFKDGDTLLLDGVVIDPWRLSLIAAAGRAEVSVARR
PRVAILATGDELAPPGASPRPDQIFESGSYGLAALIEAWGGEAIRLSPQGDDAQAIASAV
SPAPVDVIVTIGGASVGDHDLVKPALRTLGLALSVETVAVRPGKPTWSGRLPDGRRVVGL
PGNPASALVCAELFLRPLLAALTGAAPDIRLIPAGLAAPLPAGGPREHWMRAALSTDPDG
RVVATPFPDQDSSLVSVFARADALLRRRPGAPPAATGEVVDVLPLRRG