Protein Info for CCNA_03304 in Caulobacter crescentus NA1000 Δfur

Annotation: translation elongation factor G (EF-G)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 TIGR00484: translation elongation factor G" amino acids 1 to 690 (690 residues), 1097.6 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 9 to 281 (273 residues), 230.8 bits, see alignment E=2.4e-72 TIGR00231: small GTP-binding protein domain" amino acids 10 to 180 (171 residues), 131 bits, see alignment E=3.7e-42 PF03144: GTP_EFTU_D2" amino acids 323 to 390 (68 residues), 63.1 bits, see alignment E=6.8e-21 PF14492: EFG_III" amino acids 404 to 477 (74 residues), 103 bits, see alignment E=1.8e-33 PF03764: EFG_IV" amino acids 479 to 596 (118 residues), 144 bits, see alignment E=4.8e-46 PF00679: EFG_C" amino acids 600 to 686 (87 residues), 99.6 bits, see alignment E=2.1e-32

Best Hits

Swiss-Prot: 100% identical to EFG_CAUVN: Elongation factor G (fusA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to ccs:CCNA_03304)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H414 at UniProt or InterPro

Protein Sequence (692 amino acids)

>CCNA_03304 translation elongation factor G (EF-G) (Caulobacter crescentus NA1000 Δfur)
MPRTHKIEDYRNFGIMAHIDAGKTTTTERILYYTGKSHKIGEVHDGAATMDWMEQEQERG
ITITSAATTAFWNDKRLNIIDTPGHVDFTIEVERSLRVLDGAVTVLDGNAGVEPQTETVW
RQADKYKVPRIVFVNKMDKIGADFDKSVESIRDRLGAKAVPIQFPIGSESNLKGLVDLVR
MKAVVWDNDGLGASYRDEEIPADLMDKAVEARAYLVENAVELDDDAMEAYLGGEEPSIET
IKKCIRKAVLTGAFYPILCGSAFKNKGVQPLLDAVVDYLPSPVDIPPTKGIDFKTEEETT
RKASDEEPLSVLAFKIMDDPFVGSLTFCRIYSGKMETGMSLLNSTRDKRERVGRMLLMHS
NNREDIKEAYAGDIVALAGLKETRTGDTLCDPLKSPVILERMEFPAPVIEIAVEPKSKAD
QEKLGVALQKLAAEDPSFTVSTDFESGQTILKGMGELHLDIKIDILKRTYKVEANIGAPQ
VAYRESLGRKVDIDYTHKKQTGGTGQFARVMITFEPGEPGSGFVFESAIVGGAVPKEYIP
GVQKGLESVKDSGLLAGFPLIDFKATLTDGKYHDVDSSVLAFEIASRAAFKELREKGAPK
LLEPIMKVEVVTPEEYLGSVIGDLNSRRGMIQGQDMRGNATVVNAYVPLANMFGYVNTLR
GMSQGRAQFSMVYDHYDPVPQHVADEVIKKYA