Protein Info for CCNA_03273 in Caulobacter crescentus NA1000 Δfur

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details PF06532: NrsF" amino acids 10 to 214 (205 residues), 209.7 bits, see alignment E=2.1e-66

Best Hits

Swiss-Prot: 100% identical to NRSF_CAUVN: Anti-sigma-F factor NrsF (nrsF) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03273)

Predicted SEED Role

"EXTRACYTOPLASMIC FUNCTION ALTERNATIVE SIGMA FACTOR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC47 at UniProt or InterPro

Protein Sequence (214 amino acids)

>CCNA_03273 hypothetical protein (Caulobacter crescentus NA1000 Δfur)
MRTDDLIDALAADAGRGTEPAPPRRLALVAGLGGVAALLLVLGWLQARPDLGQAILGPMF
WVKAIYTGLLGLAGYLAVERLSRPGGSGRRGWIIGAVVFGACAVAGIYQAITSPDVQAAL
KLLHGYSWRSCSPRILVLGLPMLALGLWALRGMAPTRPGLAGFAMGLFSGGVVATLYGLH
CPEHTFTFLALWYSLGVLALGLIGGWAGRWLLRW