Protein Info for CCNA_03238 in Caulobacter crescentus NA1000 Δfur

Annotation: ABC-type spermidine/putrescine transport system, permease component II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 14 to 41 (28 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 107 to 132 (26 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 218 to 245 (28 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 300 (210 residues), 62.8 bits, see alignment E=1.9e-21

Best Hits

KEGG orthology group: K11071, spermidine/putrescine transport system permease protein (inferred from 100% identity to ccr:CC_3136)

Predicted SEED Role

"Putrescine transport system permease protein PotH (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CB62 at UniProt or InterPro

Protein Sequence (306 amino acids)

>CCNA_03238 ABC-type spermidine/putrescine transport system, permease component II (Caulobacter crescentus NA1000 Δfur)
MENLMEQSWKQAKAVFAAALGPPLVWLVLFFLAPMAIVWAYSFGHNVGLTEIAISGTFHN
YARAIEPLYLKIFLKSVWVAGLTTGLCLVIGFPVALAITFASDKAKAWLLLLIMLPFWTN
LLIRTYALIAVLRTEGYVNQGLEWFWKGGSGLATLIGLQPLGDFQPLELLHNNFAVILGL
VYVHLPFMVLPLYSALDRLDKSLLEASLDLGAGHLRTLFKVVVPLAIPGIASGVLITFIP
ALGAYLTPDLLGGPDSQMIANIIERQFKRANDWPFGAALSFLLMYLTFIAIAIQAVLNRK
APEAKG