Protein Info for CCNA_03236 in Caulobacter crescentus NA1000 Δfur

Annotation: spermidine/putrescine transport system permease protein potC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 271 (179 residues), 58.2 bits, see alignment E=4.7e-20

Best Hits

KEGG orthology group: K11070, spermidine/putrescine transport system permease protein (inferred from 100% identity to ccs:CCNA_03236)

Predicted SEED Role

"Putrescine transport system permease protein PotI (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CED6 at UniProt or InterPro

Protein Sequence (291 amino acids)

>CCNA_03236 spermidine/putrescine transport system permease protein potC (Caulobacter crescentus NA1000 Δfur)
MGGGVLMAKKSAPGPLEYLRRWQMQAWLAAVFIFLYAPLIALMAFSFNDSKRNIVWKGFT
LKYYEKLFNNSELLEAFGNSLTIAAASTVISLFLGAAVALALWRFRFPGKTAVDGAMALP
IVVPEICMGVAMLVFFAKVLPWPQGMPWPLNLGAIIIAHVSFSFPFVAVVVRARMASFNR
EMEEAARDLGAGEFRTIKDVILPHMAPSLIAGALLAFTLSLDDFVITFFTAGPDTVTFPV
KVYSMVRFSVTPEVNAASTVLIVLTVLLTAAALKLQGNPAAAAGHGAKDGK