Protein Info for CCNA_03226 in Caulobacter crescentus NA1000 Δfur

Annotation: basic amino acid/polyamine antiporter (APA) family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 234 to 260 (27 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 331 to 349 (19 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 391 to 409 (19 residues), see Phobius details amino acids 415 to 433 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 14 to 408 (395 residues), 182.3 bits, see alignment E=1.6e-57 PF00324: AA_permease" amino acids 24 to 419 (396 residues), 121.2 bits, see alignment E=5e-39

Best Hits

KEGG orthology group: K03759, arginine:agmatine antiporter (inferred from 100% identity to ccs:CCNA_03226)

Predicted SEED Role

"Amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CEC6 at UniProt or InterPro

Protein Sequence (438 amino acids)

>CCNA_03226 basic amino acid/polyamine antiporter (APA) family transporter (Caulobacter crescentus NA1000 Δfur)
MGGAKMTAVRSKPLGVWMCAALVVGNMIGSGVFMLPASLAPYGWNAVIAWILTIGGSLCL
AYVFAKLAGAFPRAGGPFAYTEEAFGRAPGFLVAWSYWISVWVANAAIAIAAISYLSVFL
PVIAKVPALPALLTVAVVWTATAINCAGARSAGWTQVVTTVLKLVPLIAVAGLAVSVLLR
KGPAAITPFEPSALSGASITAAAALTLWALLGVETATIPADKVKDPARTIPRATLAGTAF
AGLVYLVVSSGVLLLTPTAVLQGSNAPFVDFVSYHGGGDFRLALAAFATISALGALNGWS
LIQGELPAAMAREGVFPAWFAKTSANGTPVRAHLVSSVLVTILVLMNYAKSMADAFTFMA
LLSTTSTLFAYLFCSLAVLRLQGQGRMDRSKALTLVAALGALYSVWTFSGAGWSVTLWGL
VLLAVGAPIYWLMRRAAR