Protein Info for CCNA_03155 in Caulobacter crescentus NA1000 Δfur

Annotation: PepSY-associated transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details PF16357: PepSY_TM_like_2" amino acids 12 to 208 (197 residues), 283.3 bits, see alignment E=1.3e-88

Best Hits

KEGG orthology group: K09939, hypothetical protein (inferred from 100% identity to ccs:CCNA_03155)

Predicted SEED Role

"FIG019175: putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCE6 at UniProt or InterPro

Protein Sequence (209 amino acids)

>CCNA_03155 PepSY-associated transmembrane protein (Caulobacter crescentus NA1000 Δfur)
MKSAAAQHRRSFWLKQLHQWHWISAALSLVGMLLFAITGITLNHAGQIEAEPKVVSRKAT
LPPDLLAVLAKGPEEGKRPLPVQLESFLDEAVGADVAGREGEWSADEVYVALARPGGDAW
VSIDRETGAVEHEKTTRGAISLLNDLHKGRNTGTAWSWFIDIFAVACVIFTVTGLILLQF
HARARPLTWPLVGLGLVAPVLLVILFVHL