Protein Info for CCNA_03143 in Caulobacter crescentus NA1000 Δfur

Annotation: PAS-family sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 TIGR00229: PAS domain S-box protein" amino acids 4 to 129 (126 residues), 53 bits, see alignment E=1.9e-18 amino acids 133 to 256 (124 residues), 51.7 bits, see alignment E=4.8e-18 amino acids 257 to 380 (124 residues), 51 bits, see alignment E=7.6e-18 PF13188: PAS_8" amino acids 5 to 53 (49 residues), 16 bits, see alignment 3.2e-06 amino acids 262 to 312 (51 residues), 21.3 bits, see alignment 6.8e-08 PF00989: PAS" amino acids 6 to 120 (115 residues), 39.9 bits, see alignment E=1.4e-13 amino acids 262 to 371 (110 residues), 39.6 bits, see alignment E=1.7e-13 PF13426: PAS_9" amino acids 16 to 121 (106 residues), 21.6 bits, see alignment E=7.5e-08 amino acids 146 to 248 (103 residues), 28.8 bits, see alignment E=4.4e-10 amino acids 274 to 374 (101 residues), 19.3 bits, see alignment E=4.1e-07 PF08448: PAS_4" amino acids 147 to 250 (104 residues), 30.2 bits, see alignment E=1.6e-10 amino acids 268 to 374 (107 residues), 38.5 bits, see alignment E=4.3e-13 PF08447: PAS_3" amino acids 162 to 243 (82 residues), 50.7 bits, see alignment E=6.1e-17 amino acids 285 to 368 (84 residues), 46.4 bits, see alignment E=1.4e-15 PF07568: HisKA_2" amino acids 388 to 439 (52 residues), 27.3 bits, see alignment 1.1e-09 PF07536: HWE_HK" amino acids 388 to 470 (83 residues), 99.8 bits, see alignment E=4.2e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3048)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBI6 at UniProt or InterPro

Protein Sequence (589 amino acids)

>CCNA_03143 PAS-family sensor histidine kinase (Caulobacter crescentus NA1000 Δfur)
MSDLERLQPILATALDAVVVMDVEGVVVDWTSRAEVLLGWRREEVLGRRLSALILPSEAG
EGGAEDAALFSSSGRPSLFDVRRELMARRQDGGSIAIELSMVRWSEPDAAPLVLGFVRDI
SRRSEALKRLVVSEARFRAAIDAVQGVLWTNNASGKMVGEQPGWSALTGQIREEYEGVGW
TKVVHPDDVEPTLSAWLAAVAEKRTFEFEHRVRRHDGVWRDCLIRAVPLIGDNGEIREWV
GVHTDISEQKAAAEKLRESEALFRTLADAAPAPVWMTEPCGGMEFANAAFAELANVDREA
LLGYGWLSLLHPDDIAGLLERRQAARAGPDPYTFEARFKRQPDGWRWMLAHAKPRIDATG
AFLGYVGMAMDLSEIKNAQAQQKLLINELNHRVKNTLASIQSIARQTLRADEVSPRARDQ
FIDRLMAMSAAHNVLTNERWSGAVIDDILREALRPFCDDRDPERITITGPSVRVEPGAAL
ALALAAHELGTNAAKYGALSTPHGRVTVAWSLRGENHALVHWSESGGPEVQAPTRRGFGA
RLLERGLATDLGGKPELLFKPEGVEAQLPVRVVRADPNDQGPEQVVSPP