Protein Info for CCNA_03135 in Caulobacter crescentus NA1000 Δfur

Annotation: flagellum-specific ATP synthase fliL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR01026: ATPase, FliI/YscN family" amino acids 9 to 440 (432 residues), 503.7 bits, see alignment E=4.1e-155 TIGR03498: flagellar protein export ATPase FliI" amino acids 18 to 440 (423 residues), 653.3 bits, see alignment E=1.3e-200 PF02874: ATP-synt_ab_N" amino acids 21 to 83 (63 residues), 30.3 bits, see alignment E=7.7e-11 PF00006: ATP-synt_ab" amino acids 144 to 360 (217 residues), 269 bits, see alignment E=4.4e-84 PF18269: T3SS_ATPase_C" amino acids 370 to 437 (68 residues), 76.2 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 100% identical to FLII_CAUVN: Flagellum-specific ATP synthase (fliI) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 100% identity to ccr:CC_3040)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H363 at UniProt or InterPro

Protein Sequence (444 amino acids)

>CCNA_03135 flagellum-specific ATP synthase fliL (Caulobacter crescentus NA1000 Δfur)
MRSLIAAVERIDPLTIYGRVAAVNGLLIEVRGGLTRLAVGARVEIERFGQKPLPAEVVGF
RETRALLMPFGPVEGVGPGAEIRIVPEGAVVRPTKAWLGRIINAFGEPIDGLGPLPQGEV
PYPLKTPPPPAHARGRVGERLDLGVRSMNVFTTTCRGQRLGIFAGSGVGKSVLLSMLAKE
ATCDAVVVGLIGERGREVREFVEETLGEEGLRRAVVVVATSDEPALTRRQAAYMTLAISE
FMRDQDQEVLCLMDSVTRFAMAQREIGLAAGEPPTTKGYTPTVFTELPKLLERAGPGPIR
PDGTTAAPITALFTVLVDGDDHNEPIADATRGILDGHIVMERAIAERGRFPAINVLKSIS
RTMPGCQHPHERDIVKGARQVMSAYSNMEELIRIGAYRAGADPVVDRAIRLNPAIEAFLS
QDKEEATSLDDSFGMLGQILQSEY