Protein Info for CCNA_03131 in Caulobacter crescentus NA1000 Δfur

Annotation: LytR/AlgR-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 82 to 108 (27 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details PF04397: LytTR" amino acids 171 to 259 (89 residues), 57.7 bits, see alignment E=5.9e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3036)

Predicted SEED Role

"FIG00484190: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCC8 at UniProt or InterPro

Protein Sequence (267 amino acids)

>CCNA_03131 LytR/AlgR-family transcriptional regulator (Caulobacter crescentus NA1000 Δfur)
MSADASKPPLLGTAREWTIDLSVAVVIGILLGLMGPFGSFFNDGPAVRVAYWVCSVAFGM
VLFGTLTRLGAAAARRLGLPDWAALAPVILVGTVLLGAPLRLFAIAFWPGVIEAVSLTAW
FGQCLAISTPLVVGAYFLRARQAGQAGQASARPAVIPSLASTPSEAPPSADTSNVLYLRM
EDHYVRIRTEHGSRLEMGPLARVTAMLTGIEGLQTHRSWWVARRAIAGVVRDGRNLRLRL
VDGETAPVSRASVAKLRAAGWLADDAE