Protein Info for CCNA_03122 in Caulobacter crescentus NA1000 Δfur

Annotation: conserved membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details PF13630: SdpI" amino acids 138 to 205 (68 residues), 54.9 bits, see alignment E=7.6e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03122)

Predicted SEED Role

"FIG00482449: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CE02 at UniProt or InterPro

Protein Sequence (225 amino acids)

>CCNA_03122 conserved membrane spanning protein (Caulobacter crescentus NA1000 Δfur)
MNRRVDGLDAASWILTAGQVCLAAAIAFLGPTHPLPMHFNVSGQVDRWGDRAEMAGMVLL
LATIAVIGLLTRRWPKRAAGGEGDHGTALARFAAVLVLSMIALLSACLTWGWVDQPGPRF
GMAVVGATLALVGAVLGKTKPNAMIGVRLPWTFQSRLAWDKANRLAGRLFLWGGLAGLAA
APFAPQPLGFQALHFGVLAVAAIVIFESWRVWRSDPDRRSSWSQE