Protein Info for CCNA_03083 in Caulobacter crescentus NA1000 Δfur

Annotation: hybrid sensor histidine kinase/receiver domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 28 to 57 (30 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details PF00512: HisKA" amino acids 198 to 263 (66 residues), 61.6 bits, see alignment E=8.9e-21 PF02518: HATPase_c" amino acids 310 to 422 (113 residues), 99.5 bits, see alignment E=2.4e-32 PF00072: Response_reg" amino acids 454 to 565 (112 residues), 71.4 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2988)

Predicted SEED Role

"Putative Sensor histidine kinase with PAS and Response regulator receiver domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAQ3 at UniProt or InterPro

Protein Sequence (574 amino acids)

>CCNA_03083 hybrid sensor histidine kinase/receiver domain protein (Caulobacter crescentus NA1000 Δfur)
MARPLLDDSIDLIASTGRQARPARLGMAVLVAGFLGFNVSAAIAIVWFAAAMVAEVYGLG
VTRLSRRLNLSPVLRRLGYVTVVIVMVGVWTALTLVLWTSGNPALQWAAICLAAGQLIHA
QSVTFRAPVLFAIDVGMPSTSLIVMPILTGGFAPVQIATMMTAVALMLLYTFTSATANNR
RIAALEAAEAQALKASEAKSAFLAMISHEIRTPMNGVLAMTDALSRADLGPDQARQTALL
KRSGEDLMTLLNDVLDISRIEAGKLEIECQPFDLPELLGDLRALWTPAATDKGLDLVLTI
APGLDAYRLGDPTRLRQILGNLVSNAVKFTRSGGVALSARPGEAPGAVVFDVADTGIGMT
PEQQGRLFQSFSQADASIARRFGGSGLGLSICSQLATLMDGAITVDSDLGSGSTFRLTLP
LPVTERPAAPAPAEPAADTAETPATPDSLAGLTVLVADDHPVNQAVARAILEAVGARVAV
ADNGEAALASLKSAPADLVLMDLHMPGLGGRETVRRIRRGEGGDPAVPIIALTGEALGED
PAAWRAEGFDAVQQKPVVARDLLAAAARLTARTA