Protein Info for CCNA_03076 in Caulobacter crescentus NA1000 Δfur

Annotation: excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 749 TIGR00631: excinuclease ABC subunit B" amino acids 46 to 706 (661 residues), 1015.7 bits, see alignment E=0 PF04851: ResIII" amino acids 56 to 134 (79 residues), 45.2 bits, see alignment E=3e-15 PF00270: DEAD" amino acids 59 to 126 (68 residues), 28.4 bits, see alignment E=4e-10 PF17757: UvrB_inter" amino acids 202 to 290 (89 residues), 104.2 bits, see alignment E=9.9e-34 PF00271: Helicase_C" amino acids 481 to 591 (111 residues), 73.6 bits, see alignment E=4.6e-24 PF12344: UvrB" amino acids 598 to 639 (42 residues), 75.2 bits, see alignment 8.3e-25 PF02151: UVR" amino acids 675 to 706 (32 residues), 34.6 bits, see alignment (E = 3.4e-12)

Best Hits

Swiss-Prot: 71% identical to UVRB_ZYMMO: UvrABC system protein B (uvrB) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to ccr:CC_2981)

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCA9 at UniProt or InterPro

Protein Sequence (749 amino acids)

>CCNA_03076 excinuclease ABC subunit B (Caulobacter crescentus NA1000 Δfur)
MPSRDTSGVSDVSTPFVLDTVPGGAIPALWTPHRPSRPDKSEGGKKFKLVSDYQPAGDQP
TAIAELVEGLQNGDQDQVLLGVTGSGKTFTMAQVIARTQRPALILAPNKTLAAQLYSEMK
SFFPENAVEYFVSYYDYYQPEAYVPRTDTYIEKDSSINEQIDRMRHSATRAILERDDVIV
VASVSCIYGIGSVETYTAMTFTLEVGQRVDEKQLIADLVAQQYKRNDQAFERGTFRRRGD
TIEIFPAHYEDRAWRVTMFGDEVEALSEFDTLTGKKTADLEMIKVYANSHHVTPRPTLRQ
AIIAIRQELKERLEWLTANGKLLEAQRLEQRTTFDLEMIETTGSCAGIENYSRYLSGRKT
GEPPPTFFEYIPDNALLFTDESHQTVPQIGAMYKGDRNRKWTLAEYGFRLPSALDNRPLK
FEEWDAMRPQSVHVSATPANWELERAGGVFAEQVIRPTGLIDPPVEVRPVSKDGASQVDD
VVDEIRQTIQKGYRTLVTVLTKKMAEDLTEYLTEQGIRVRYMHSDVDTIERIEIIRDLRL
GHFDVLVGINLLREGLDIPECGLVAILDADKEGFLRSETSLIQTIGRAARNVDGKVILYA
DRVTGSMERAMAETARRREKQHAYNLEHGITPESVKRDIKDILNSPYERGDRVLVPMGMS
ETDDRPFSGDNFKAALKDLEAKMREAAANLEFETAARLRDEIKRMKLMDLEFANEVLTAP
GEAVDKAMPKRVRAELRAEQAEAFRKSRL