Protein Info for CCNA_03047 in Caulobacter crescentus NA1000 Δfur
Annotation: 4-amino-4-deoxychorismate lyase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00826, branched-chain amino acid aminotransferase [EC: 2.6.1.42] (inferred from 100% identity to ccs:CCNA_03047)Predicted SEED Role
"Aminodeoxychorismate lyase (EC 4.1.3.38)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 4.1.3.38)
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- L-leucine biosynthesis (6/6 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- L-valine biosynthesis (4/4 steps found)
- superpathway of L-alanine biosynthesis (4/4 steps found)
- superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
- L-leucine degradation I (5/6 steps found)
- 4-aminobenzoate biosynthesis I (2/2 steps found)
- L-alanine biosynthesis I (2/2 steps found)
- L-isoleucine biosynthesis II (6/8 steps found)
- L-isoleucine biosynthesis V (2/3 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- L-isoleucine biosynthesis IV (4/6 steps found)
- L-isoleucine degradation I (4/6 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- 4-aminobenzoate biosynthesis II (1/2 steps found)
- L-valine degradation I (5/8 steps found)
- L-isoleucine biosynthesis III (4/7 steps found)
- L-isoleucine degradation III (oxidative Stickland reaction) (1/3 steps found)
- L-leucine degradation V (oxidative Stickland reaction) (1/3 steps found)
- L-valine degradation III (oxidative Stickland reaction) (1/3 steps found)
- L-leucine degradation IV (reductive Stickland reaction) (1/5 steps found)
- superpathway of candicidin biosynthesis (4/11 steps found)
- superpathway of L-threonine metabolism (9/18 steps found)
- superpathway of chorismate metabolism (38/59 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Folate biosynthesis
- Pantothenate and CoA biosynthesis
- Valine, leucine and isoleucine biosynthesis
- Valine, leucine and isoleucine degradation
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.42
Use Curated BLAST to search for 2.6.1.42 or 4.1.3.38
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3CDT0 at UniProt or InterPro
Protein Sequence (251 amino acids)
>CCNA_03047 4-amino-4-deoxychorismate lyase (Caulobacter crescentus NA1000 Δfur) MTRPDAVPLNDRGLLLGDGLFETMLAQDGAVAHLPAHLDRMAAGCAVLGLPFDREAAQRL VLAAAPSQGRFAIRLTLTAGSGGRGLDRPEAPAVRLFATAAPSTPVTTPATLIVAATRRN EGSPASRLKTLAYLDNVLARAEARAAGADDALMLNNRGEIACAAAANLFWLAGGRLFTPR LDCGVLAGTTRARLLAREAVEEVAVGVEALEAAEAVVLTNSLIGVRPVSRLGERALPEHP LAARLNARLDA