Protein Info for CCNA_03042 in Caulobacter crescentus NA1000 Δfur

Annotation: pilus assembly prepilin peptidase CpaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details PF01478: Peptidase_A24" amino acids 10 to 113 (104 residues), 61.8 bits, see alignment E=3.8e-21

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 100% identity to ccs:CCNA_03042)

Predicted SEED Role

"Type IV prepilin peptidase TadV/CpaA" in subsystem Widespread colonization island

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.43

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDS6 at UniProt or InterPro

Protein Sequence (170 amino acids)

>CCNA_03042 pilus assembly prepilin peptidase CpaA (Caulobacter crescentus NA1000 Δfur)
MQALQIPLLLIFPALAIVGALKDLTSYTIPNWISLALIAAFVPAALVSGAPLSQIGLCLA
VGLGALVLGMGMFAAGWIGGGDGKLFAVCALWLGWPAALTFMLYTGLAGGVLTFAILGLR
SGWLAPAVAGGPAWLRKLGTTGGDLPYGVAIAVGALAAFPQGALALGILG