Protein Info for CCNA_03029 in Caulobacter crescentus NA1000 Δfur

Annotation: 3-deoxy-manno-octulosonate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF02348: CTP_transf_3" amino acids 5 to 214 (210 residues), 132.3 bits, see alignment E=2.4e-42 PF12804: NTP_transf_3" amino acids 18 to 160 (143 residues), 49.1 bits, see alignment E=7.6e-17

Best Hits

Swiss-Prot: 58% identical to KDSB_PARL1: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 100% identity to ccr:CC_2934)

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CB80 at UniProt or InterPro

Protein Sequence (245 amino acids)

>CCNA_03029 3-deoxy-manno-octulosonate cytidylyltransferase (Caulobacter crescentus NA1000 Δfur)
MNPLILIPARMAATRLPGKPLADIGGVPMIVRVLRQGLEAGIGPVAVAAGDPEIVEAVQK
AGGTAVLTDPDLPSGSDRILAALAQLDPGFAHDVVINLQGDMPFVDPAVLSDCARILKEF
GDADIATVVAPEASPADRANPDVVKAVLAMEEDGQSGRALYFTRSTLYGDGPVWRHIGIY
GYRREALEAFNAAAPSPLEKREKLEQLRAMELGLTIRAAVAKTAPISVDNPSDLEAARKQ
AEETR