Protein Info for CCNA_02906 in Caulobacter crescentus NA1000 Δfur

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 124 to 140 (17 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 236 to 251 (16 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 17 to 343 (327 residues), 88.1 bits, see alignment E=3.1e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2815)

Predicted SEED Role

"FIG00481445: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBT7 at UniProt or InterPro

Protein Sequence (364 amino acids)

>CCNA_02906 acyltransferase family protein (Caulobacter crescentus NA1000 Δfur)
MPKLPPLQPDSDQMLHLDALRIVGAVMIVVFHFNRFINLDGQWQWADDTIKTFSLIVDLF
FFISGYVMAAIYTGRLTSFAAYRDFIQKRVARLGPLHWATMLVFIAVAAAGAAGWVQDRD
PRRYDVACIVPNIVFVHAWGVCHSQTWNFASWAISAEMGLYLALPLIFLLTARGPWITLG
VALASVAIMLQTPHGDRPFHQWTWDYGVLRAVPGFLIGMAAFQLRDRLAKIPRPNLLMWL
LLGGYLIMSWAGVERTILLFVVYAVGLLGVAADAKGVHGGVSRRLAPWAQLSFSLYLLHP
IALKMGLAWVGLGMWNLNGDLMRLWVLFWVVALFPIAYLSLVFFERPARDWLAKVGKENK
LPLS