Protein Info for CCNA_02848 in Caulobacter crescentus NA1000 Δfur

Annotation: heme chaperone-apocytochrome heme-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details amino acids 449 to 468 (20 residues), see Phobius details amino acids 492 to 512 (21 residues), see Phobius details amino acids 623 to 643 (21 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 53 to 648 (596 residues), 596.7 bits, see alignment E=3.1e-183 PF01578: Cytochrom_C_asm" amino acids 89 to 295 (207 residues), 157.5 bits, see alignment E=3.8e-50 PF16327: CcmF_C" amino acids 315 to 645 (331 residues), 338.7 bits, see alignment E=3.8e-105

Best Hits

Swiss-Prot: 52% identical to CCMF_RHIME: Cytochrome c-type biogenesis protein CycK (cycK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 100% identity to ccs:CCNA_02848)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBM0 at UniProt or InterPro

Protein Sequence (660 amino acids)

>CCNA_02848 heme chaperone-apocytochrome heme-lyase (Caulobacter crescentus NA1000 Δfur)
MIVELGAFALILSLMLSVAQTGLSAVGGARRSPVLAGAGQGAAIATFVALLVSFAALIYA
FVTSDFSVTNVATNSHTDKPMLYKVAGAWGSHEGSMLLWCLVLTGFGAAMAVFGDSLPPR
LRAYAIAVQGGLGVMFLAYTVLASNPLARLLEAPIEGKSLNPLLQDWALAFHPPFLYVGY
VGFSVVYSLSMAALIEGRIDAAWARWIRPWTLAAWSMLTVGITLGAFWAYYELGWGGWWF
WDPVENASFMPWLIGAALLHSAIVTERRGALPGWTAFLALAAYTFSMLGAFLVRSGVLTS
VHAFAVDPTRGVLLLIMMAVAAGAGFLLFGLRAPSLNRGGQFRPISRESAIVLNNILLST
ATAVVLLGTLYPLIREAMDGEAVSVGAPFFNLTFTPLMILAFAVLPAGPLLAWKRGDAKG
VARKLWVVLALAALLGLIAYAVVQPRKALASGGLVVGFWLIGGALLEIAERLKLARAPFA
ESLRRAHGLPRGAWGTTLAHAGLGVFVLGASFETAWRVEAAQALSLNGSQPLGAYTVTLT
DVVTIEGPNYLAERGIITVTNKAGAEVCRAQPERRFYPTGAQTTSEVAICAKGLDDIYVV
MGERRAGEGGKPAWLVRAYVNPWVRLIFLGPLLMAVGGIVSLSDRRVRLGVGRRTGEVVS