Protein Info for CCNA_02833 in Caulobacter crescentus NA1000 Δfur

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details PF01794: Ferric_reduct" amino acids 98 to 211 (114 residues), 65.8 bits, see alignment E=2e-22

Best Hits

Swiss-Prot: 100% identical to MSRQ_CAUVC: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02833)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBK4 at UniProt or InterPro

Protein Sequence (253 amino acids)

>CCNA_02833 hypothetical protein (Caulobacter crescentus NA1000 Δfur)
MPGPRFSLCVWGGLAMASALSPKRRRVRSGPRHSPGKSARRGVVAEPRRKKRPSKLQDTL
VYGLVWLACFAPLAWLAWRGYAGELGANPIDKLIRELGEWGLRLLLVGLAITPAARILKM
PRLVRFRRTVGLFAFAYVALHLLAYVGIDLFFDWNQLWKDILKRPFITLGMLGFMLLIPL
AVTSTNGWVIRMGRAAWSRLHRLVYLIVPLGVAHYYLLVKADHRPPIIYGAVFVALMLWR
VWEGRRTASKSSP