Protein Info for CCNA_02807 in Caulobacter crescentus NA1000 Δfur

Annotation: nickel-cobalt-cadmium resistance protein NccB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF16576: HlyD_D23" amino acids 105 to 321 (217 residues), 69 bits, see alignment E=7.3e-23 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 111 to 399 (289 residues), 154 bits, see alignment E=2.4e-49 PF13437: HlyD_3" amino acids 223 to 314 (92 residues), 56.9 bits, see alignment E=6.5e-19

Best Hits

Swiss-Prot: 44% identical to NCCB_ALCXX: Nickel-cobalt-cadmium resistance protein NccB (nccB) from Alcaligenes xylosoxydans xylosoxydans

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02807)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAR8 at UniProt or InterPro

Protein Sequence (411 amino acids)

>CCNA_02807 nickel-cobalt-cadmium resistance protein NccB (Caulobacter crescentus NA1000 Δfur)
MIRALDWKKLLAALAISGLIAVSAAALIGRSRPAPKATPPAVAIKAEQHEGGEADHVAGH
IESKAGVGQTDKEGHIDMSAERLAASGIRVETLMAGGLSAGIVAQASVVGSPDGAATLAA
RADGAVVRINKRLGDAVAAGEPLALIESRDAAAISSEYAAAAAKATAARQTFVRERRLFD
AKITARQDLEAALAEIAIAEAELRRAINAGAAAGVSADGRYVTVSSPIAGKITAAPLVLG
SYVAAGTELFRVADPRKIEVQAWLPASDAARIAAGDQALIETSQGALPAVVRSITPGVDV
ESRAATAILTLRQGHKGLVPGQAVRVRIIPRGAAAGERVSVPEEAVQSVKGADSVFVRGK
DGFTARPVKIGRRGGDRVEILSGLTAGEQIAGQGAFLLKAELGKGEAEHGH